PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538693.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 386aa    MW: 41827.5 Da    PI: 6.1197
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538693.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS290.73.9e-89543552309
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lLl+cAeav+ ++l +a+ lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l+ ++ +  +s +   a+++++ +sP++kf
  KN538693.1_FGP011  54 LSLLLRCAEAVAMDQLPEARDLLPEIAELASPFGSSPERVAAYFGDALCARVLSSYLGAYSPLALRPLAAAQSRRISGAFQAYNALSPLVKF 145
                        689******************************************************************999******************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                        sh+taNqaI +a++ge+rvH+iD+di+qGlQWp L++ LasRp +p slRiTg+g+    s + le+tg+rLa+fA++lg+pfef+++  k 
  KN538693.1_FGP011 146 SHFTANQAIFQALDGEDRVHVIDLDIMQGLQWPGLFHILASRPTKPRSLRITGLGA----SLDVLEATGRRLADFAASLGLPFEFQPIEGKI 233
                        ********************************************************....9**************************76665 PP

               GRAS 186 ledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                         +  +  +L   +  gEa++V++++  h l+d ++s +     +++l+ksl+Pk++++veq++ h s++Fl rf+eal+yysalfd+l  ++
  KN538693.1_FGP011 234 GHVADAAALLGPRhhGEATVVHWMH--HCLYDVTGSDAG----TVRLLKSLRPKLITIVEQDLGH-SGDFLGRFVEALHYYSALFDALGDGA 318
                        555566666443358*********9..888888888888....**********************.899*******************5443 PP

               GRAS 276 pres...eerikvErellgreivnvvacegaerrerh 309
                        ++++    er+ vEr+llg ei+n+va  g +r+ + 
  KN538693.1_FGP011 319 GAAEeeaAERHAVERQLLGAEIRNIVAVGGPKRTGEA 355
                        333323699***********************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.12927386IPR005202Transcription factor GRAS
PfamPF035141.3E-8654355IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MKAKRAADDE EEGGERERAR GKRLAAEGKQ GLVVVSTGEE EEEAAAETRG LRLLSLLLRC  60
AEAVAMDQLP EARDLLPEIA ELASPFGSSP ERVAAYFGDA LCARVLSSYL GAYSPLALRP  120
LAAAQSRRIS GAFQAYNALS PLVKFSHFTA NQAIFQALDG EDRVHVIDLD IMQGLQWPGL  180
FHILASRPTK PRSLRITGLG ASLDVLEATG RRLADFAASL GLPFEFQPIE GKIGHVADAA  240
ALLGPRHHGE ATVVHWMHHC LYDVTGSDAG TVRLLKSLRP KLITIVEQDL GHSGDFLGRF  300
VEALHYYSAL FDALGDGAGA AEEEAAERHA VERQLLGAEI RNIVAVGGPK RTGEASSFVP  360
SPGCHEQHHF NYKIELFFLQ KELKLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-39533444296GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1201400.0AK120140.1 Oryza sativa Japonica Group cDNA clone:J013027P17, full insert sequence.
GenBankAP0038660.0AP003866.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1092_A07.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644982.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-138SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA2YMR90.0A2YMR9_ORYSI; Putative uncharacterized protein
TrEMBLA3BLA00.0A3BLA0_ORYSJ; Uncharacterized protein
TrEMBLI1QEA40.0I1QEA4_ORYGL; Uncharacterized protein
STRINGBGIOSGA025964-PA0.0(Oryza sativa Indica Group)
STRINGORGLA07G0244600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-121GRAS family protein